DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14491 and CG33796

DIOPT Version :10

Sequence 1:NP_611276.1 Gene:CG14491 / 37046 FlyBaseID:FBgn0034284 Length:166 Species:Drosophila melanogaster
Sequence 2:NP_001027128.1 Gene:CG33796 / 3771914 FlyBaseID:FBgn0053796 Length:179 Species:Drosophila melanogaster


Alignment Length:130 Identity:36/130 - (27%)
Similarity:55/130 - (42%) Gaps:15/130 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVF--TNCSCSSEDPEGMLSLLKCGLSKSVK--RPSFNIELQFKKPVAKFFVNMRIVLPRRFGDD 61
            :||  ||..|.|.: :..:.:.:|.| |::.  |..||....|..|.....|:.: ...|..|..
  Fly    25 VVFKLTNVHCGSYN-KTWIRINQCRL-KAINRHRTVFNFNATFLYPTKSITVHYQ-TFKRENGYR 86

  Fly    62 FTLFNLSGIDGCSLLSNKNQIAFIQLGRKHMDRFSNIPKRCPWPKDV---NYYIRGFRSDMATMP 123
            ..|.| :.||||..|........|.|...:.: |:||...||...|:   |.|:   .:|:..:|
  Fly    87 PWLVN-TQIDGCRFLRKPYDALGILLFNIYRN-FTNINHTCPLQGDMIVRNMYL---TTDVMRLP 146

  Fly   124  123
              Fly   147  146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14491NP_611276.1 DM8 60..150 CDD:214778 19/67 (28%)
CG33796NP_001027128.1 DUF1091 74..154 CDD:461928 22/79 (28%)

Return to query results.
Submit another query.