powered by:
Protein Alignment CG14491 and CG33645
DIOPT Version :9
Sequence 1: | NP_611276.1 |
Gene: | CG14491 / 37046 |
FlyBaseID: | FBgn0034284 |
Length: | 166 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001027260.3 |
Gene: | CG33645 / 3771913 |
FlyBaseID: | FBgn0053645 |
Length: | 189 |
Species: | Drosophila melanogaster |
Alignment Length: | 55 |
Identity: | 13/55 - (23%) |
Similarity: | 29/55 - (52%) |
Gaps: | 0/55 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 71 DGCSLLSNKNQIAFIQLGRKHMDRFSNIPKRCPWPKDVNYYIRGFRSDMATMPAF 125
:||.:|.|.|:.....:..:::.:.||:..:||:..:|:|.::.........|:|
Fly 95 NGCYILENANKNRLFNMYVQNLKKHSNVKFKCPFRANVSYEVKNLTMSEQDFPSF 149
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG14491 | NP_611276.1 |
DM8 |
60..150 |
CDD:214778 |
13/55 (24%) |
CG33645 | NP_001027260.3 |
DUF1091 |
80..156 |
CDD:310821 |
13/55 (24%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
P |
PTHR20898 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
2 | 2.010 |
|
Return to query results.
Submit another query.