DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14491 and CG14492

DIOPT Version :9

Sequence 1:NP_611276.1 Gene:CG14491 / 37046 FlyBaseID:FBgn0034284 Length:166 Species:Drosophila melanogaster
Sequence 2:NP_611275.2 Gene:CG14492 / 37045 FlyBaseID:FBgn0034283 Length:199 Species:Drosophila melanogaster


Alignment Length:168 Identity:72/168 - (42%)
Similarity:108/168 - (64%) Gaps:18/168 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 NCSCSSED-PEGMLSLLKCGLSKSVKRPSFNIELQFKKPVAK--FFVNMRIVLPRRFG-DDFTLF 65
            |.:|||:| ...:|....||:|||.||.::::|...::|||:  ||:  :||||||.. .||.|.
  Fly    38 NFTCSSDDISSSVLKEFTCGISKSTKRRTWHMEFVLEQPVAEHDFFI--KIVLPRRRPLPDFVLL 100

  Fly    66 NLSGIDGCSLLSNKNQIAFIQLGRKHMDRFSNIPKRCPWPKDVNYYIRGFRSDMATMPAFNFETD 130
            |:: .|||.||:|:||:..::|||..|:||||.||:||:..:..|||||||.|:..:||.:.||.
  Fly   101 NVT-TDGCQLLANRNQVPLMRLGRNIMERFSNFPKQCPFKPNFTYYIRGFRLDLNLVPAVDMETP 164

  Fly   131 MNLWFELVVNQHK-----LIRGFIQSRVQR---RKNAK 160
            :.:.|.   :|:|     .|.|::.:||||   :|.:|
  Fly   165 VQIEFS---HQNKQQGIRWITGYLMARVQRISEKKRSK 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14491NP_611276.1 DM8 60..150 CDD:214778 41/94 (44%)
CG14492NP_611275.2 DM8 95..186 CDD:214778 41/94 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441206
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2FBQA
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0014292
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.