DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14491 and CG33454

DIOPT Version :10

Sequence 1:NP_611276.1 Gene:CG14491 / 37046 FlyBaseID:FBgn0034284 Length:166 Species:Drosophila melanogaster
Sequence 2:NP_995887.1 Gene:CG33454 / 2768850 FlyBaseID:FBgn0053454 Length:173 Species:Drosophila melanogaster


Alignment Length:102 Identity:28/102 - (27%)
Similarity:44/102 - (43%) Gaps:5/102 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 TNCSCSSEDPEGMLSLLKCGL-SKSVKRPSFNIELQFKKPVAKFFVNMRIVLPRRFGDDFTLFNL 67
            ||..|.|.| :.:.....|.| :.|..:.|.:|...|..|:....|..: :|.|..|....||::
  Fly    28 TNVVCESYD-KSLTVFHYCRLKAYSRTKTSLHINATFLHPINSISVRFQ-MLKRANGYKPFLFDI 90

  Fly    68 SGIDGCSLLSNKNQIAFIQLGRKHMDRFSNIPKRCPW 104
            : :|.|..|...|. ..|::....:...|||...||:
  Fly    91 T-VDACQFLRKPNN-PVIKIVYNMIKDASNINHSCPY 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14491NP_611276.1 DM8 60..150 CDD:214778 12/45 (27%)
CG33454NP_995887.1 DUF1091 72..148 CDD:461928 16/57 (28%)

Return to query results.
Submit another query.