DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14491 and CG33477

DIOPT Version :10

Sequence 1:NP_611276.1 Gene:CG14491 / 37046 FlyBaseID:FBgn0034284 Length:166 Species:Drosophila melanogaster
Sequence 2:NP_995797.1 Gene:CG33477 / 2768726 FlyBaseID:FBgn0053477 Length:198 Species:Drosophila melanogaster


Alignment Length:113 Identity:25/113 - (22%)
Similarity:45/113 - (39%) Gaps:17/113 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 IELQFKKPVAKFFVNMRIV-LPRRFGDDFT---------LFNLSGIDGCSLLSNKNQIAFIQLGR 89
            :|...:.|.:|.....|:| |...|..:.|         ::.:....||..|:  |.:.|...|.
  Fly    66 VEYFHRVPDSKILYTFRVVKLAPAFTINITIKVLKTHRIMYKIENFKGCEFLN--NPVIFKMFGE 128

  Fly    90 KHMDRFSNIPK-RCPWPKDVNYYIR--GFRSDMATMPAF-NFETDMNL 133
            .:.....|... :||...:| ||::  |..|.:.::..| .|:..|.:
  Fly   129 SYKTLVVNGSYFKCPIKPNV-YYLKTDGIMSMIPSVHPFGRFQLSMRV 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14491NP_611276.1 DM8 60..150 CDD:214778 18/87 (21%)
CG33477NP_995797.1 DUF1091 100..171 CDD:461928 16/73 (22%)

Return to query results.
Submit another query.