DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14492 and CG14456

DIOPT Version :10

Sequence 1:NP_611275.2 Gene:CG14492 / 37045 FlyBaseID:FBgn0034283 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_001137998.1 Gene:CG14456 / 40481 FlyBaseID:FBgn0037176 Length:213 Species:Drosophila melanogaster


Alignment Length:98 Identity:21/98 - (21%)
Similarity:40/98 - (40%) Gaps:16/98 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 HMEFVLE--QPVAEHDFFIKIVLPRRRPLPDFVLLNVTTDGCQLLANRNQVPLMRLGRNIMERFS 130
            |:.|.:|  |.:.:.|..:::.:..::.......||.|.:.|::|...|:.|:.|.....:..|.
  Fly    53 HLNFSMEVHQELHDVDIHVEVRITNKQDPYYNTNLNTTLNVCRILGFANKSPVGRFVHGFIREFG 117

  Fly   131 NFPKQCPF--------------KPNFTYYIRGF 149
            |..:.||.              |...:|:|..|
  Fly   118 NIVETCPIAKGRYHWHRIHLKRKLQGSYFINKF 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14492NP_611275.2 DM8 95..186 CDD:214778 16/69 (23%)
CG14456NP_001137998.1 DM8 82..189 CDD:214778 16/69 (23%)

Return to query results.
Submit another query.