DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14492 and CG13250

DIOPT Version :10

Sequence 1:NP_611275.2 Gene:CG14492 / 37045 FlyBaseID:FBgn0034283 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_649245.1 Gene:CG13250 / 40284 FlyBaseID:FBgn0037013 Length:192 Species:Drosophila melanogaster


Alignment Length:181 Identity:43/181 - (23%)
Similarity:71/181 - (39%) Gaps:35/181 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 LQTDNFTCSSDDISSSVLKEFTCGISKSTKRRTWHMEFVLEQPVAEHDFFIKIVLPRR------- 91
            |.|.:|.....||:.||:...|..|.|..         ::|.|..:.:|....:|.||       
  Fly    26 LATRDFDIRWRDINCSVIDPTTAEIFKCD---------IVEMPKKQGNFLNTFLLLRRSVTKMWV 81

  Fly    92 ------------RPLPDFVLLNVTTDGCQLLANRNQVPLMRLGRNIMERFSNFPKQCPFKPNFTY 144
                        ||:..  |..:..|||.|:..|::..::....:.:.:..|:|..||...|..|
  Fly    82 ELSVGQIANRKDRPVQQ--LFKIRVDGCHLIEFRSKSRILNAVLHKLLQSGNYPDACPLLANVNY 144

  Fly   145 YIRGFRLDLNLVPAV--DMETPVQIEFSHQNKQQGIRWITGYLMARVQRIS 193
            ....|.|:.:..||.  ||:...::.| ..::..|:  |...:.|.|.|.|
  Fly   145 TSTRFALNPDHFPAYMPDMKFNTKLVF-QLSRNMGL--IRASVDAEVMRRS 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14492NP_611275.2 DM8 95..186 CDD:214778 21/92 (23%)
CG13250NP_649245.1 DM8 95..181 CDD:214778 21/90 (23%)

Return to query results.
Submit another query.