DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14492 and CG12849

DIOPT Version :10

Sequence 1:NP_611275.2 Gene:CG14492 / 37045 FlyBaseID:FBgn0034283 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_611969.2 Gene:CG12849 / 37971 FlyBaseID:FBgn0035068 Length:172 Species:Drosophila melanogaster


Alignment Length:172 Identity:35/172 - (20%)
Similarity:62/172 - (36%) Gaps:46/172 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 WMVIFLYLLPNWKLEAEAKNNFELQTDNFTCSSDDISSSVLKEFTCGISKSTKRRTWHMEF---V 72
            |..:.:::.|     ...:.:||.  :|..|.   :...:..:|.....||..|...::..   :
  Fly     5 WTFLLIFMSP-----MAIRGHFEF--NNVVCL---VRDRMFMDFEYCYLKSVNRTYKYLSLKTKM 59

  Fly    73 LEQPV--AEHDFFIKIVLPRRRPLPDFVLLNVTTDGCQLLANRNQVPLMRLGRNIMERF---SNF 132
            ...||  .|..|.:: :...||.|.:|   :...|.|:.:.:|..|    :...:.:.|   ||.
  Fly    60 FRLPVDNCETRFQLR-MRENRRVLYNF---DFKVDSCKFMRDRKHV----IANWVYQTFGPYSNL 116

  Fly   133 PKQCPFKPNFTYYIRGFRLDLNLVPAVDMETPVQIEFSHQNK 174
            ...||:..:..       ||         :.|||    |.||
  Fly   117 NHTCPYDHDIV-------LD---------KLPVQ----HLNK 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14492NP_611275.2 DM8 95..186 CDD:214778 18/83 (22%)
CG12849NP_611969.2 DM8 80..172 CDD:214778 20/86 (23%)

Return to query results.
Submit another query.