DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14492 and CG13589

DIOPT Version :10

Sequence 1:NP_611275.2 Gene:CG14492 / 37045 FlyBaseID:FBgn0034283 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_611918.2 Gene:CG13589 / 37906 FlyBaseID:FBgn0035011 Length:174 Species:Drosophila melanogaster


Alignment Length:41 Identity:12/41 - (29%)
Similarity:22/41 - (53%) Gaps:1/41 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 LLNVTTDGCQLLANRNQVPLMRLGRNIMERFSNFPKQCPFK 139
            |.:.|.|.|:.:..||| |..::..|:::..|.....||::
  Fly    87 LFDYTFDACEFMRRRNQ-PFAKIVWNMIKNVSTVNHTCPYE 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14492NP_611275.2 DM8 95..186 CDD:214778 12/41 (29%)
CG13589NP_611918.2 DM8 83..171 CDD:214778 12/41 (29%)

Return to query results.
Submit another query.