DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14492 and CG33795

DIOPT Version :10

Sequence 1:NP_611275.2 Gene:CG14492 / 37045 FlyBaseID:FBgn0034283 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_001027129.2 Gene:CG33795 / 3772625 FlyBaseID:FBgn0053795 Length:178 Species:Drosophila melanogaster


Alignment Length:172 Identity:41/172 - (23%)
Similarity:69/172 - (40%) Gaps:22/172 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 MVIFLYLLPNWKLEAEAKNNFELQTDNFTCSSDDISSSVLKEFTCGISKSTKRRT-WHMEFVLEQ 75
            :||.:..|..|:|....  .::|  .|..|.|.:.|...:.|  |.:....:.|| ::....:..
  Fly     8 VVILVTFLLTWRLSYSV--TYKL--TNVICESRNQSWVTINE--CRLKAVNRNRTVFNFNATIHH 66

  Fly    76 P----VAEHDFFIKIVLPRRRPLPDFVLLNVTTDGCQLLANRNQVPLMRLGRNIMERFSNFPKQC 136
            |    |.::.|     |.|......: |.....|||:.|.....: |.::...:.:.|||....|
  Fly    67 PTNDVVIDYRF-----LKRENGYKPW-LYKKNIDGCRFLRKPYDM-LTKMIYMVFKPFSNINHTC 124

  Fly   137 PFKPNFTYYIRG--FRLDLNLVPAVDMETPVQIEFSHQNKQQ 176
            ||..:.  .|||  .|.::..:|....:..:||.:|...|.|
  Fly   125 PFYGDI--LIRGMYLRTEIKAMPYPSGKYMLQINWSFYKKIQ 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14492NP_611275.2 DM8 95..186 CDD:214778 22/84 (26%)
CG33795NP_001027129.2 DUF1091 77..153 CDD:461928 20/84 (24%)

Return to query results.
Submit another query.