DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14492 and CG33914

DIOPT Version :10

Sequence 1:NP_611275.2 Gene:CG14492 / 37045 FlyBaseID:FBgn0034283 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_001027394.2 Gene:CG33914 / 3772464 FlyBaseID:FBgn0053914 Length:189 Species:Drosophila melanogaster


Alignment Length:109 Identity:20/109 - (18%)
Similarity:47/109 - (43%) Gaps:12/109 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 NFTCSSDDISSSVLKEFTCGISKSTKRRTWHMEFVLEQPVAEH-DFFIKIVLPRRRPL------- 94
            |.||.|.|:|.|:: |:....:.|..:.:..:.:.:.:|:..: :.:.:::......:       
  Fly    30 NVTCESKDLSMSIV-EYCAVTTLSKNKNSISLRYAMLKPMFTNIEIYFQLMTRGSESIHAASNWQ 93

  Fly    95 PDFVLLNVTTDGCQLLANRNQVPLMRLGRNIMERFSNFPKQCPF 138
            |  .|..:..|.|:...|.:. .|.|:....::..:|....||:
  Fly    94 P--FLHTMKLDLCRFWKNHHN-HLARMVFEFIDGHTNMNHTCPY 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14492NP_611275.2 DM8 95..186 CDD:214778 10/44 (23%)
CG33914NP_001027394.2 DUF1091 88..166 CDD:461928 10/50 (20%)

Return to query results.
Submit another query.