DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14492 and CG33792

DIOPT Version :9

Sequence 1:NP_611275.2 Gene:CG14492 / 37045 FlyBaseID:FBgn0034283 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_001027411.2 Gene:CG33792 / 3772111 FlyBaseID:FBgn0053792 Length:225 Species:Drosophila melanogaster


Alignment Length:99 Identity:26/99 - (26%)
Similarity:40/99 - (40%) Gaps:29/99 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 DGCQLLANRNQVP-LMRLGRNIMERFSNFPKQCPFKPN--------FTYYI-------------R 147
            |.||||.|:.|.. |.:...:.:..::|....||::.:        |:.||             |
  Fly   100 DVCQLLKNKTQSNFLQKYAISHLTEWTNVNHSCPYRVSLCIYNIVKFSQYIEYIYMFLKGHLIAR 164

  Fly   148 GFRLD---LNLVPAVDMETPVQIEFSHQNKQQGI 178
            .||||   |.::|..|    .:|.|:......||
  Fly   165 NFRLDEVSLPILPIQD----YKIAFNFSGANPGI 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14492NP_611275.2 DM8 95..186 CDD:214778 26/99 (26%)
CG33792NP_001027411.2 DUF1091 82..183 CDD:284008 22/86 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.