DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14492 and CG33783

DIOPT Version :10

Sequence 1:NP_611275.2 Gene:CG14492 / 37045 FlyBaseID:FBgn0034283 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_001027168.1 Gene:CG33783 / 3771958 FlyBaseID:FBgn0053783 Length:164 Species:Drosophila melanogaster


Alignment Length:68 Identity:20/68 - (29%)
Similarity:30/68 - (44%) Gaps:6/68 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 RPLPDFVLLNVTTDGCQLLANRNQVPLMRLGRNIMERFSNFPKQCPFKPNFTYYIRGFRLDLNLV 156
            ||.    |.|:|.|.|....||.:.|.:.|..:.::.|||....||.  |....:....|:.|::
  Fly    68 RPF----LYNMTVDICSFFKNRKRYPFVDLVYDAIKNFSNVNHSCPH--NHDIIVNRMVLNDNMI 126

  Fly   157 PAV 159
            ..|
  Fly   127 VKV 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14492NP_611275.2 DM8 95..186 CDD:214778 18/65 (28%)
CG33783NP_001027168.1 DUF1091 60..138 CDD:461928 20/68 (29%)

Return to query results.
Submit another query.