DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14492 and CG33922

DIOPT Version :9

Sequence 1:NP_611275.2 Gene:CG14492 / 37045 FlyBaseID:FBgn0034283 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_001027217.1 Gene:CG33922 / 3771945 FlyBaseID:FBgn0053922 Length:178 Species:Drosophila melanogaster


Alignment Length:146 Identity:33/146 - (22%)
Similarity:59/146 - (40%) Gaps:28/146 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 ELQTDNFTCSSDDISSSVLKE-FTCGISKSTKRRTWHMEFVLEQPVAEHDFFIKIVLPRRRPLPD 96
            :|:..|..|.:.|...:|... |...::::.|..:..:: :|:.||:.    :||.:...:.|..
  Fly    23 KLEFTNIKCVTLDPEFAVFHYCFLKSVNRTYKYYSLKVK-LLKTPVSN----VKINIATFQRLNG 82

  Fly    97 F--VLLNVTTDGCQLLANRNQVPLMRLGRNIMERFSNFPKQCPFKPNFTYYIRGFRLDLNLVPAV 159
            :  .|.|||.|||:...::...|:.....|..:.:||....||       |.....||       
  Fly    83 YKPFLYNVTVDGCRFYKHQRSNPVFSYFFNFFKDYSNINHSCP-------YDHDIILD------- 133

  Fly   160 DMETPVQIEFSHQNKQ 175
                  ::..||.|.|
  Fly   134 ------KVSISHANTQ 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14492NP_611275.2 DM8 95..186 CDD:214778 20/83 (24%)
CG33922NP_001027217.1 DUF1091 72..156 CDD:284008 22/92 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.