DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14492 and CG33645

DIOPT Version :10

Sequence 1:NP_611275.2 Gene:CG14492 / 37045 FlyBaseID:FBgn0034283 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_001027260.3 Gene:CG33645 / 3771913 FlyBaseID:FBgn0053645 Length:189 Species:Drosophila melanogaster


Alignment Length:137 Identity:29/137 - (21%)
Similarity:58/137 - (42%) Gaps:24/137 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 NWKLEAEAKNNFELQTDNFTCSSDDISSSVLKEFTCGISKSTKRRTWHMEFVLEQPV------AE 79
            |:::..:..|...|.||            :.::|.|.:.:...|.......:.::.|      |.
  Fly    23 NFRVYIKEVNITHLDTD------------LYEKFECKVYQVDNRTYMDSVHIFKRTVDDITVHAA 75

  Fly    80 HDFFIKIVLPRRRPLPDFVLLNVTTDGCQLLANRNQVPLMRLGRNIMERFSNFPKQCPFKPNFTY 144
            .||: |:...::..|.|     |..:||.:|.|.|:..|..:....:::.||...:|||:.|.:|
  Fly    76 LDFW-KLNSKQKMKLYD-----VQFNGCYILENANKNRLFNMYVQNLKKHSNVKFKCPFRANVSY 134

  Fly   145 YIRGFRL 151
            .::...:
  Fly   135 EVKNLTM 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14492NP_611275.2 DM8 95..186 CDD:214778 15/57 (26%)
CG33645NP_001027260.3 DUF1091 80..156 CDD:461928 17/67 (25%)

Return to query results.
Submit another query.