powered by:
Protein Alignment CG14492 and CG33768
DIOPT Version :9
Sequence 1: | NP_611275.2 |
Gene: | CG14492 / 37045 |
FlyBaseID: | FBgn0034283 |
Length: | 199 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001027142.2 |
Gene: | CG33768 / 3771840 |
FlyBaseID: | FBgn0053768 |
Length: | 175 |
Species: | Drosophila melanogaster |
Alignment Length: | 60 |
Identity: | 20/60 - (33%) |
Similarity: | 33/60 - (55%) |
Gaps: | 2/60 - (3%) |
- Green bases have known domain annotations that are detailed below.
Fly 99 LLNVTTDGCQLLANRNQVPLMRLGRNIMERFSNFPKQCPFKPNFTYYIRGFRLDLNLVPA 158
|:...||.|:||:.... .|.|.....:.:.|||.:.||. |...||::|:.:::.|||:
Fly 80 LVQADTDYCELLSTLKD-SLFRRWIKSVSKNSNFMENCPV-PAGHYYLKGWHVEMGLVPS 137
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG14492 | NP_611275.2 |
DM8 |
95..186 |
CDD:214778 |
20/60 (33%) |
CG33768 | NP_001027142.2 |
DM8 |
76..167 |
CDD:214778 |
20/60 (33%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
P |
PTHR20898 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.100 |
|
Return to query results.
Submit another query.