powered by:
Protein Alignment CG14492 and CG33642
DIOPT Version :9
Sequence 1: | NP_611275.2 |
Gene: | CG14492 / 37045 |
FlyBaseID: | FBgn0034283 |
Length: | 199 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001027257.1 |
Gene: | CG33642 / 3771733 |
FlyBaseID: | FBgn0053642 |
Length: | 187 |
Species: | Drosophila melanogaster |
Alignment Length: | 60 |
Identity: | 15/60 - (25%) |
Similarity: | 28/60 - (46%) |
Gaps: | 1/60 - (1%) |
- Green bases have known domain annotations that are detailed below.
Fly 105 DGCQLLANRNQVPLMRLGRNIMERFSNFPKQCPFKPNFTYYIRGFRLD-LNLVPAVDMET 163
|.||.|...::..|.::.....::..:....||.:.||.|.:..:.:| .:|.|.|.:.|
Fly 99 DACQFLKTSHRNGLFKIYVKSFKKHIHGNLSCPLRTNFNYTLTNWHMDEKDLPPFVPLGT 158
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG14492 | NP_611275.2 |
DM8 |
95..186 |
CDD:214778 |
15/60 (25%) |
CG33642 | NP_001027257.1 |
DUF1091 |
79..160 |
CDD:284008 |
15/60 (25%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
P |
PTHR20898 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
2 | 2.010 |
|
Return to query results.
Submit another query.