DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14492 and CG33453

DIOPT Version :10

Sequence 1:NP_611275.2 Gene:CG14492 / 37045 FlyBaseID:FBgn0034283 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_995888.1 Gene:CG33453 / 2768851 FlyBaseID:FBgn0053453 Length:175 Species:Drosophila melanogaster


Alignment Length:116 Identity:27/116 - (23%)
Similarity:52/116 - (44%) Gaps:13/116 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 AEAKNNFELQTDNFTCSSDDISSSVLKEFTCGISKSTKRRT-WHMEFVLEQPVAEHDFFIKIV-- 87
            :||.|   ::..|..|.|.:.|.:|.  ..|.:...::.:| .::......|.......:|:|  
  Fly    22 SEAPN---IKLTNVVCESINKSWAVF--HYCRLKAYSRNKTSLNINATFLHPTNNVSLRLKMVKR 81

  Fly    88 LPRRRPLPDFVLLNVTTDGCQLLANRNQVPLMRLGRNIMERFSNFPKQCPF 138
            |...:|.    |.:||.|.||.|..|:. |::::..:.::.:|.....||:
  Fly    82 LSGYKPF----LFDVTIDACQFLRKRHN-PVIKMFYSFIKDYSTLNHTCPY 127

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14492NP_611275.2 DM8 95..186 CDD:214778 12/44 (27%)
CG33453NP_995888.1 DUF1091 78..149 CDD:461928 15/55 (27%)

Return to query results.
Submit another query.