DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14492 and CG30050

DIOPT Version :10

Sequence 1:NP_611275.2 Gene:CG14492 / 37045 FlyBaseID:FBgn0034283 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_725159.2 Gene:CG30050 / 246417 FlyBaseID:FBgn0050050 Length:192 Species:Drosophila melanogaster


Alignment Length:77 Identity:18/77 - (23%)
Similarity:37/77 - (48%) Gaps:2/77 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 KRRTWHMEFVLEQPVAEHDFFIKIVLPRRRPLPDFVLLNVTTDGCQLLANRNQVPLMRLGRNIME 127
            |.||......:.|.::.....:::.:|..:.:.. .:.::|.|.|::|..|.:..|:.|..|.:.
  Fly    56 KNRTMEASVNIMQQLSVFSGSLRVSIPNAKKVIT-QIFDITFDVCKVLRERKRKILIDLLVNTLA 119

  Fly   128 RFSNFPK-QCPF 138
            :.||... :|||
  Fly   120 KNSNAKAWRCPF 131

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14492NP_611275.2 DM8 95..186 CDD:214778 13/45 (29%)
CG30050NP_725159.2 DM8 90..177 CDD:214778 13/42 (31%)

Return to query results.
Submit another query.