DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Mapmodulin and Lrriq3

DIOPT Version :9

Sequence 1:	NP_001097361.1	Gene:	Mapmodulin / 37043	FlyBaseID:	FBgn0034282	Length:	363	Species:	Drosophila melanogaster
Sequence 2:	NP_001019478.1	Gene:	Lrriq3 / 499732	RGDID:	1591943	Length:	633	Species:	Rattus norvegicus

Alignment Length:	138	Identity:	36/138 - (26%)
Similarity:	56/138 - (40%)	Gaps:	26/138 - (18%)

- Green bases have known domain annotations that are detailed below.

  Fly    21 NLDNCRSTSIVGLTDEYTALESLSLINVGLTTLKGFPKLPNLKKLELSDNRIS--------SGLN 77
            ||.:|.|..:...::.:.         ..:..|:|..|   |.||:|..|:|.        :||.
  Rat    45 NLQSCISLRVCIFSNNFV---------TDIQPLQGCKK---LIKLDLHGNQIKTLPDRTFWNGLK 97

  Fly    78 YLTTSPKLQYLNLSGNKIKDLETLKPLEEFKNLVVLDLFNNDATQVDNYREKIFKMLPSLNFLDG 142
            .|    ||.||:  .|....|:.:..|....|||.|.:|:...:....||..:...:..|..||.
  Rat    98 NL----KLLYLH--DNGFAKLKNICVLSGCVNLVGLTMFDCPVSLKKGYRHVLVNSIWPLKALDH 156

  Fly   143 FDCNDEEV 150
            ...:|||:
  Rat   157 HVISDEEI 164

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Mapmodulin	NP_001097361.1	leucine-rich repeat	17..39	CDD:275380	4/17 (24%)
		LRR_4	38..74	CDD:289563	9/43 (21%)
		LRR_8	40..95	CDD:290566	17/62 (27%)
		leucine-rich repeat	40..61	CDD:275380	3/20 (15%)
		LRR_4	60..103	CDD:289563	15/50 (30%)
		leucine-rich repeat	62..84	CDD:275380	9/29 (31%)
		LRR_4	83..125	CDD:289563	12/41 (29%)
		leucine-rich repeat	85..109	CDD:275380	6/23 (26%)
		leucine-rich repeat	110..136	CDD:275380	6/25 (24%)
Lrriq3	NP_001019478.1	PPP1R42	36..>128	CDD:411060	26/100 (26%)
		LRR 1	51..72		3/29 (10%)
		leucine-rich repeat	52..73	CDD:275378	2/29 (7%)
		LRR 2	73..94		7/23 (30%)
		leucine-rich repeat	74..98	CDD:275378	8/23 (35%)
		LRR 3	98..119		7/26 (27%)
		leucine-rich repeat	99..115	CDD:275378	7/21 (33%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	322..343
		DUF5401	<388..>586	CDD:375164
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	0	0.000