| Sequence 1: | NP_001097361.1 | Gene: | Mapmodulin / 37043 | FlyBaseID: | FBgn0034282 | Length: | 363 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_036536.2 | Gene: | ANP32D / 23519 | HGNCID: | 16676 | Length: | 131 | Species: | Homo sapiens |
| Alignment Length: | 129 | Identity: | 67/129 - (51%) |
|---|---|---|---|
| Similarity: | 85/129 - (65%) | Gaps: | 3/129 - (2%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 1 MEKRIELERRARKVNQITELNLDNCRST--SIVGLTDEYTALESLSLINVGLTTLKGFPKLPNLK 63
Fly 64 KLELSDNRISSGLNYLTTS-PKLQYLNLSGNKIKDLETLKPLEEFKNLVVLDLFNNDATQVDNY 126 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Mapmodulin | NP_001097361.1 | leucine-rich repeat | 17..39 | CDD:275380 | 11/23 (48%) |
| LRR_4 | 38..74 | CDD:289563 | 20/35 (57%) | ||
| LRR_8 | 40..95 | CDD:290566 | 32/55 (58%) | ||
| leucine-rich repeat | 40..61 | CDD:275380 | 11/20 (55%) | ||
| LRR_4 | 60..103 | CDD:289563 | 27/43 (63%) | ||
| leucine-rich repeat | 62..84 | CDD:275380 | 13/22 (59%) | ||
| LRR_4 | 83..125 | CDD:289563 | 23/41 (56%) | ||
| leucine-rich repeat | 85..109 | CDD:275380 | 15/23 (65%) | ||
| leucine-rich repeat | 110..136 | CDD:275380 | 8/17 (47%) | ||
| ANP32D | NP_036536.2 | LRR 1 | 18..38 | 7/19 (37%) | |
| LRR 2 | 43..64 | 10/20 (50%) | |||
| LRR 3 | 65..87 | 13/21 (62%) | |||
| LRR_4 | 88..130 | CDD:289563 | 23/41 (56%) | ||
| LRR 4 | 89..110 | 14/20 (70%) | |||
| leucine-rich repeat | 90..113 | CDD:275382 | 15/22 (68%) | ||
| LRR 5 | 114..131 | 7/16 (44%) |
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C165147565 | |
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG2739 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 1 | 1.000 | - | - | FOG0001011 | |
| OrthoInspector | 1 | 1.000 | - | - | otm40376 | |
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 1 | 1.000 | - | - | X672 | |
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 1 | 0.960 | - | - | ||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 7 | 6.700 | |||||