DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14490 and RSPH1

DIOPT Version :9

Sequence 1:NP_611274.1 Gene:CG14490 / 37041 FlyBaseID:FBgn0034281 Length:197 Species:Drosophila melanogaster
Sequence 2:NP_543136.1 Gene:RSPH1 / 89765 HGNCID:12371 Length:309 Species:Homo sapiens


Alignment Length:160 Identity:55/160 - (34%)
Similarity:87/160 - (54%) Gaps:15/160 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 GQYQGKWLGQ----QPHGFGVKQTSSGLVYEGHWQKGQRHGIGSLRRKELDGRMERIYVGQWREN 80
            |:|:|   |:    :.||.|..:..:|..|||.::.|:|||.|..:.|  :|..   |:|::..|
Human    18 GEYEG---GRNEAGERHGRGRARLPNGDTYEGSYEFGKRHGQGIYKFK--NGAR---YIGEYVRN 74

  Fly    81 KRSGEGKQFYPDGSVYFGQWLADQRSGEGILWQADGGIYVGEWLRDKMHEKG-LLFTATGNRYVG 144
            |:.|:|...|||||.|.|:|..|.|.|.|:.:..:...|.|||...:.|.:| .|:..||::|||
Human    75 KKHGQGTFIYPDGSRYEGEWANDLRHGHGVYYYINNDTYTGEWFAHQRHGQGTYLYAETGSKYVG 139

  Fly   145 QFEGGCKSGSGVFYHASNGQRIQHGFWSKD 174
            .:..|.:.|:....|.::  |.|..|.:|:
Human   140 TWVNGQQEGTAELIHLNH--RYQGKFLNKN 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14490NP_611274.1 COG4642 35..170 CDD:226989 47/135 (35%)
RSPH1NP_543136.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..42 7/26 (27%)
COG4642 20..>148 CDD:332236 48/135 (36%)
MORN 1 20..43 7/25 (28%)
MORN 2 44..66 10/23 (43%)
MORN 3 67..89 10/21 (48%)
MORN 4 90..112 7/21 (33%)
MORN 5 113..135 8/21 (38%)
MORN 6 159..181 3/9 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 222..309
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4642
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1309439at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.