DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG14490 and JPH4

DIOPT Version :9

Sequence 1:	NP_611274.1	Gene:	CG14490 / 37041	FlyBaseID:	FBgn0034281	Length:	197	Species:	Drosophila melanogaster
Sequence 2:	NP_001139500.1	Gene:	JPH4 / 84502	HGNCID:	20156	Length:	628	Species:	Homo sapiens

Alignment Length:	131	Identity:	46/131 - (35%)
Similarity:	62/131 - (47%)	Gaps:	32/131 - (24%)

- Green bases have known domain annotations that are detailed below.

  Fly     7 GYSSGVRSQRY-----PG--GQYQGKWLGQQPHGF---GVKQTSSGLVYEGHWQKGQRHGIGSLR 61
            |:.:| |:..|     ||  |:|.|.|    .|||   ||.....|..|:||||:|:|.|:|..|
Human    18 GWEAG-RAHGYGVCTGPGAQGEYSGCW----AHGFESLGVFTGPGGHSYQGHWQQGKREGLGVER 77

  Fly    62 RKE----------LDGR---MERI----YVGQWRENKRSGEGKQFYPDGSVYFGQWLADQRSGEG 109
            :..          |.||   .|.:    |.|.|::..:.|.|.:.|.||..|.|||.|.:|.|.|
Human    78 KSRWTYRGEWLGGLKGRSGVWESVSGLRYAGLWKDGFQDGYGTETYSDGGTYQGQWQAGKRHGYG 142

  Fly   110 I 110
            :
Human   143 V 143

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG14490	NP_611274.1	COG4642	35..170	CDD:226989	33/93 (35%)
JPH4	NP_001139500.1	PLN03185	5..>143	CDD:215619	45/129 (35%)
		MORN 1	50..72		10/21 (48%)
		MORN 2	74..95		4/20 (20%)
		MORN 3	96..117		4/20 (20%)
		MORN 4	118..140		10/21 (48%)
		MORN 5	141..163		1/3 (33%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	158..214
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	231..276
		PLN03185	281..>340	CDD:215619
		MORN 7	317..339
		MORN 8	340..362
		PRK07003	<369..>606	CDD:235906
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	415..602
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG4642
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.900