DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14490 and AT1G77660

DIOPT Version :9

Sequence 1:NP_611274.1 Gene:CG14490 / 37041 FlyBaseID:FBgn0034281 Length:197 Species:Drosophila melanogaster
Sequence 2:NP_177889.1 Gene:AT1G77660 / 844102 AraportID:AT1G77660 Length:421 Species:Arabidopsis thaliana


Alignment Length:155 Identity:50/155 - (32%)
Similarity:74/155 - (47%) Gaps:7/155 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 YPGGQYQGKWLGQQPHGFGVKQTSSGLVYEGHWQKGQRHGIGSLRRKELDGRMERIYVGQWRENK 81
            |..|:|:|.|:..:..|:|::..|.|..|:|.:::|.|||.|.......|.     |.|:|...:
plant   201 YVNGRYEGDWINGRYDGYGIECWSKGSKYKGQYKQGLRHGFGVYWFYTGDS-----YSGEWFNGQ 260

  Fly    82 RSGEGKQFYPDGSVYFGQWLADQRSGEGILWQADGGIYVGEWLRDKMHEKGLLFTATGNRYVGQF 146
            ..|.|.|...|||.:.|::....:.|.|.....:|..|.||:..||:|..|:...|.|:.|.|.:
plant   261 SHGFGVQTCADGSSFVGEFKFGVKHGLGSYHFRNGDKYAGEYFGDKIHGFGVYHFANGHYYEGAW 325

  Fly   147 EGGCKSGSGVFYHASNGQRIQHGFW 171
            ..|.|.|.|. |....|. |:.|.|
plant   326 HEGRKQGYGT-YRFRTGD-IKSGEW 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14490NP_611274.1 COG4642 35..170 CDD:226989 42/134 (31%)
AT1G77660NP_177889.1 PLN03185 173..>351 CDD:215619 50/155 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4642
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1309439at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23084
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.880

Return to query results.
Submit another query.