DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14490 and AT4G17080

DIOPT Version :9

Sequence 1:NP_611274.1 Gene:CG14490 / 37041 FlyBaseID:FBgn0034281 Length:197 Species:Drosophila melanogaster
Sequence 2:NP_193441.5 Gene:AT4G17080 / 827416 AraportID:AT4G17080 Length:513 Species:Arabidopsis thaliana


Alignment Length:209 Identity:60/209 - (28%)
Similarity:90/209 - (43%) Gaps:30/209 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 YSSGVRSQRYPG------------------GQYQGKWLGQQPHGFGVKQTSSGLVYEGHWQKGQR 54
            ||||   ..|.|                  |:|:|.|:..:..|:||:..:.|..|.|.:::|.|
plant   256 YSSG---DVYEGEFHRGKCSGSGVYYYSMKGKYEGDWIDGKYDGYGVETWAKGSRYRGQYRQGMR 317

  Fly    55 HGIGSLRRKELDGRMERIYVGQWRENKRSGEGKQFYPDGSVYFGQWLADQRSGEGILWQADGGIY 119
            ||.|..|....|     :|.|:|...:..|.|.....|||.:.|::....:.|.|.....:|..|
plant   318 HGTGIYRFYTGD-----VYAGEWSNGQSHGCGVYTSEDGSRFVGEFKWGVKHGLGHYHFRNGDTY 377

  Fly   120 VGEWLRDKMHEKGLLFTATGNRYVGQFEGGCKSGSGVFYHASNGQRIQHGFWSKDI--CRTSLLS 182
            .||:..|:||..|:.....|:||.|.:..|.:.|.|: |...||: .|.|.|...:  |.|...:
plant   378 AGEYFADRMHGFGVYQFGNGHRYEGAWHEGRRQGLGM-YTFRNGE-TQAGHWEDGVLNCPTEQTT 440

  Fly   183 LPQDKNNEFMSKAL 196
            .|....:...||.:
plant   441 RPDSSFSISHSKVV 454

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14490NP_611274.1 COG4642 35..170 CDD:226989 42/134 (31%)
AT4G17080NP_193441.5 EcfT 156..>219 CDD:410987
PLN03185 256..>415 CDD:215619 49/167 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4642
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1309439at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23084
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.970

Return to query results.
Submit another query.