DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14490 and MORN1

DIOPT Version :9

Sequence 1:NP_611274.1 Gene:CG14490 / 37041 FlyBaseID:FBgn0034281 Length:197 Species:Drosophila melanogaster
Sequence 2:NP_079124.1 Gene:MORN1 / 79906 HGNCID:25852 Length:497 Species:Homo sapiens


Alignment Length:139 Identity:47/139 - (33%)
Similarity:71/139 - (51%) Gaps:5/139 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 GVRSQRYPGGQYQGKWLGQQPHGFGVKQTSSGLVYEGHWQKGQRHGIGSLRRKELDGRMERIYVG 75
            |.|...:.|..:.|:::..:|.|:||.:..:|..|||....|.|.|.|.|  .:.||   ::|.|
Human    75 GRRHWAWSGDTFSGQFVLGEPQGYGVMEYKAGGCYEGEVSHGMREGHGFL--VDRDG---QVYQG 134

  Fly    76 QWRENKRSGEGKQFYPDGSVYFGQWLADQRSGEGILWQADGGIYVGEWLRDKMHEKGLLFTATGN 140
            .:.:|||.|.|:..:.:|..|.|.|:.|:|.|.|:|..|||..|.|:|..|.....|.:...:|.
Human   135 SFHDNKRHGPGQMLFQNGDKYDGDWVRDRRQGHGVLRCADGSTYKGQWHSDVFSGLGSMAHCSGV 199

  Fly   141 RYVGQFEGG 149
            .|.|.:..|
Human   200 TYYGLWING 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14490NP_611274.1 COG4642 35..170 CDD:226989 41/115 (36%)
MORN1NP_079124.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..27
MORN 39..61 CDD:280628
MORN 1 39..61
COG4642 59..191 CDD:226989 42/120 (35%)
MORN 2 62..84 2/8 (25%)
MORN 3 86..108 6/21 (29%)
MORN 4 109..131 10/26 (38%)
MORN 5 132..154 8/21 (38%)
MORN 155..177 CDD:280628 11/21 (52%)
MORN 6 155..177 11/21 (52%)
MORN 7 178..200 6/21 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 393..425
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 468..497
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165156967
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4642
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1309439at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.