DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14490 and Morn1

DIOPT Version :9

Sequence 1:NP_611274.1 Gene:CG14490 / 37041 FlyBaseID:FBgn0034281 Length:197 Species:Drosophila melanogaster
Sequence 2:XP_030109754.1 Gene:Morn1 / 76866 MGIID:1924116 Length:608 Species:Mus musculus


Alignment Length:83 Identity:21/83 - (25%)
Similarity:27/83 - (32%) Gaps:15/83 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 GQWLADQRSGEGILWQADGGIYVGEWLRDKMHEKGLLFTATGNRYVGQFEGG------------- 149
            |||.:|..||.|.|....|..|.|.::.....|:.......|...:...:|.             
Mouse   311 GQWHSDVFSGLGSLVHCSGVTYCGMFINGHPAEQAKKIVILGPEVLEVVQGSPFTLSVQLQQDDG 375

  Fly   150 --CKSGSGVFYHASNGQR 165
              .||.||.....|.|.|
Mouse   376 EVAKSESGRVLKISAGVR 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14490NP_611274.1 COG4642 35..170 CDD:226989 21/83 (25%)
Morn1XP_030109754.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167847370
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4642
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.