DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14490 and rsph10b

DIOPT Version :9

Sequence 1:NP_611274.1 Gene:CG14490 / 37041 FlyBaseID:FBgn0034281 Length:197 Species:Drosophila melanogaster
Sequence 2:NP_001070227.1 Gene:rsph10b / 767792 ZFINID:ZDB-GENE-060929-300 Length:731 Species:Danio rerio


Alignment Length:176 Identity:54/176 - (30%)
Similarity:76/176 - (43%) Gaps:29/176 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 RSQRYPG---GQ------------YQGKWLGQQPHGFGVKQTSSGLVYEGHWQKGQRHGIGSLRR 62
            |.|.|.|   ||            |:|:|:.....|:|.:...||.||||.|:...|||.|::|.
Zfish   180 RGQWYLGKRQGQGEMFYNQEATSWYKGEWVNNCREGWGKRCYPSGNVYEGQWRNNVRHGEGTMRW 244

  Fly    63 KELDGRMERIYVGQWRENKRSGEG----------KQFYPDGSVYFGQWLADQRSGEGILWQADGG 117
            .:||.:    |.|||....:.|:|          ...||..:.|.|.::...|.|:|....|.|.
Zfish   245 IDLDQQ----YSGQWINGIQEGKGTHTWFRKRAPSSQYPRMNEYTGDFVQAMRHGQGQFLYASGA 305

  Fly   118 IYVGEWLRDKMHEKGLLFTATGNRYVGQFEGGCKSGSGVFYHASNG 163
            :|.|:|..||.|.:|......|..|.|:|...|.:....|....:|
Zfish   306 LYCGQWKYDKKHGQGRYIFENGRVYEGEFSKDCMAEFPAFTPGLSG 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14490NP_611274.1 COG4642 35..170 CDD:226989 44/139 (32%)
rsph10bNP_001070227.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..69
MORN 1 86..108
MORN 2 109..131
MORN 109..129 CDD:280628
MORN 3 132..154
MORN 4 155..177
MORN 5 179..201 6/20 (30%)
COG4642 194..334 CDD:226989 44/143 (31%)
MORN 6 204..226 7/21 (33%)
MORN 225..246 CDD:197832 10/20 (50%)
MORN 7 227..249 10/21 (48%)
MORN 8 251..273 6/21 (29%)
MORN 9 284..306 7/21 (33%)
MORN 10 307..329 8/21 (38%)
MORN 307..327 CDD:280628 7/19 (37%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 353..377
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 709..731
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4642
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1309439at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.