DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14490 and Morn3

DIOPT Version :9

Sequence 1:NP_611274.1 Gene:CG14490 / 37041 FlyBaseID:FBgn0034281 Length:197 Species:Drosophila melanogaster
Sequence 2:NP_083388.1 Gene:Morn3 / 74890 MGIID:1922140 Length:241 Species:Mus musculus


Alignment Length:186 Identity:70/186 - (37%)
Similarity:108/186 - (58%) Gaps:6/186 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 SGVRSQRYP--GGQYQGKWLGQQPHGFGVK-QTSSGLVYEGHWQKGQRHGIGSLRRKELD-GRME 70
            :|:|.|.:.  |..|.|:|.|...||.|.: ...||.||||.|:.|:|.|.|||...:.: |::.
Mouse    24 NGLRHQVFAVNGDHYVGEWKGNLKHGKGTQVWKKSGAVYEGDWKFGKRDGYGSLSHPDPETGKLR 88

  Fly    71 RIYVGQWRENKRSGEGKQFYPDGSVYFGQWLADQRSGEGILWQADGGIYVGEWLRDKMHEKGLLF 135
            |:|.|.|:.:|:||.|.||:.....|.|:|..:||||.|.::..:|.||.|:|..||...:|:|.
Mouse    89 RVYSGWWKGDKKSGYGIQFFGPKEYYEGEWCNNQRSGWGRMYYNNGDIYEGQWQNDKPEGEGMLR 153

  Fly   136 TATGNRYVGQFEGGCKSGSGVFYHASNGQRIQHGFWSKDICRT-SLLSLPQDKNNE 190
            ...||||.|.:|.|.|:|.|.|:|..:||..: |:|..::.:. :::...:|:..|
Mouse   154 LKNGNRYEGIWERGMKNGHGRFFHLDHGQLFE-GYWVDNVAKCGTMIDFGRDEAPE 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14490NP_611274.1 COG4642 35..170 CDD:226989 56/136 (41%)
Morn3NP_083388.1 PLN03185 34..>190 CDD:215619 65/156 (42%)
MORN 1 38..60 8/21 (38%)
MORN 2 62..84 10/21 (48%)
MORN 3 91..113 9/21 (43%)
MORN 4 114..136 9/21 (43%)
MORN 5 137..159 8/21 (38%)
MORN 6 160..182 9/21 (43%)
MORN 7 184..205 2/21 (10%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4642
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H42069
Inparanoid 1 1.050 133 1.000 Inparanoid score I4586
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG56904
OrthoDB 1 1.010 - - D1309439at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm43699
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4901
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1110.870

Return to query results.
Submit another query.