DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14490 and RSPH10B2

DIOPT Version :9

Sequence 1:NP_611274.1 Gene:CG14490 / 37041 FlyBaseID:FBgn0034281 Length:197 Species:Drosophila melanogaster
Sequence 2:XP_006715829.1 Gene:RSPH10B2 / 728194 HGNCID:34385 Length:875 Species:Homo sapiens


Alignment Length:217 Identity:64/217 - (29%)
Similarity:92/217 - (42%) Gaps:54/217 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 GGQYQGKWLGQQPHGFGV-KQTSSGLVYEGHWQKGQRHGIGSLRRKELDGRMERIYVGQWRENKR 82
            |..|:|:.:....:|||: |.::..:.|.|||..|:|||.||:...: :|..  .|.|.|.:|.:
Human   152 GSMYEGEVVNGMRNGFGMFKCSTQPVSYIGHWCNGKRHGKGSIYYNQ-EGTC--WYEGDWVQNIK 213

  Fly    83 SGEGKQFYPDGSVYFGQWLADQRSGEG-ILWQADGGIYVGEWLRDKMHEKGLLFTAT-------- 138
            .|.|.:.|..|::|.|||..:.|.||| :.|......|.|.|.|...:..|   |.|        
Human   214 KGWGIRCYKSGNIYEGQWEDNMRHGEGRMRWLTTNEEYTGRWERGIQNGFG---THTWFLKRIRS 275

  Fly   139 -----GNRYVGQFEGGCKSGSGVFYHAS---------------------------NGQRIQHGFW 171
                 .|.|:|:|..|.:.|.|.||:||                           || |:..|.:
Human   276 SQYPLRNEYIGEFVNGYRHGRGKFYYASGAMYDGEWVSNKKHGMFFCLQGRLTFKNG-RVYEGAF 339

  Fly   172 SKDICRTSLLSLPQDKNNEFMS 193
            |.|    .:...| |...||:|
Human   340 SND----HIAGFP-DLEVEFIS 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14490NP_611274.1 COG4642 35..170 CDD:226989 51/176 (29%)
RSPH10B2XP_006715829.1 COG4642 <86..162 CDD:226989 3/9 (33%)
PLN03185 128..>318 CDD:215619 53/171 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1309439at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.