DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14490 and Morn3

DIOPT Version :9

Sequence 1:NP_611274.1 Gene:CG14490 / 37041 FlyBaseID:FBgn0034281 Length:197 Species:Drosophila melanogaster
Sequence 2:XP_038946061.1 Gene:Morn3 / 687615 RGDID:1583091 Length:269 Species:Rattus norvegicus


Alignment Length:188 Identity:71/188 - (37%)
Similarity:110/188 - (58%) Gaps:10/188 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 SGVRSQRYP--GGQYQGKWLGQQPHGFGV---KQTSSGLVYEGHWQKGQRHGIGSLRRKELD-GR 68
            :|:|.|.:.  |..|.|:|.|...||.|.   ||  ||.:|||.|:.|:|.|.|.|...:.: |:
  Rat    52 NGLRHQVFAVNGDHYVGEWKGNLKHGKGTQVWKQ--SGAMYEGDWKFGKRDGYGILSHPDPETGK 114

  Fly    69 MERIYVGQWRENKRSGEGKQFYPDGSVYFGQWLADQRSGEGILWQADGGIYVGEWLRDKMHEKGL 133
            ::|:|.|.|:.:|:||.|.||:.....|.|:|.::||||.|.::..:|.||.|:|..||...:|:
  Rat   115 LKRVYSGWWKGDKKSGYGIQFFGPKEYYEGEWCSNQRSGWGRMYYNNGDIYEGQWKNDKPDGEGM 179

  Fly   134 LFTATGNRYVGQFEGGCKSGSGVFYHASNGQRIQHGFWSKDICRT-SLLSLPQDKNNE 190
            |....||||.|.:|.|.|:|.|.|:|..:||..: |||..::.:. :::...:|:..|
  Rat   180 LRLKNGNRYEGSWERGMKNGHGRFFHLDHGQLFE-GFWVDNVAKCGTMIDFGRDEAPE 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14490NP_611274.1 COG4642 35..170 CDD:226989 56/138 (41%)
Morn3XP_038946061.1 PLN03185 62..>216 CDD:215619 64/156 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4642
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H42069
Inparanoid 1 1.050 133 1.000 Inparanoid score I4504
OMA 1 1.010 - - QHG56904
OrthoDB 1 1.010 - - D1309439at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm45776
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.880

Return to query results.
Submit another query.