DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14490 and Jph3

DIOPT Version :9

Sequence 1:NP_611274.1 Gene:CG14490 / 37041 FlyBaseID:FBgn0034281 Length:197 Species:Drosophila melanogaster
Sequence 2:NP_065630.1 Gene:Jph3 / 57340 MGIID:1891497 Length:744 Species:Mus musculus


Alignment Length:189 Identity:53/189 - (28%)
Similarity:80/189 - (42%) Gaps:49/189 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 GYSSGVRSQRYPGGQYQGKWLGQQPHGF---GVKQTSSGLVYEGHWQKGQRHGIGSLRRKELDGR 68
            |..:|.:.|    |:|.|.|    .|||   ||....||..|:|.|.:|:|||||      |:.:
Mouse    28 GVCTGPKGQ----GEYTGSW----SHGFEVLGVYTWPSGNTYQGTWAQGKRHGIG------LESK 78

  Fly    69 MERIYVGQWRENKRSGEG-KQFYPDGSVYFGQWLADQRSGEGILWQADGGIYVGEWLRDKMHEKG 132
            .:.:|.|:|....:...| ::...:|:.|.|.|....:.|.|....:|||.|.|:|:        
Mouse    79 GKWVYKGEWTHGFKGRYGVRECTGNGAKYEGTWSNGLQDGYGTETYSDGGTYQGQWV-------- 135

  Fly   133 LLFTATGNRYVGQFEGGCKSGSGVFYHASNGQRIQHGFWS--KDICRTSLLSLPQDKNN 189
                           ||.:.|.||      .|.:.:|..:  :...|||:.||..:..|
Mouse   136 ---------------GGMRQGYGV------RQSVPYGMAAVIRSPLRTSINSLRSEHTN 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14490NP_611274.1 COG4642 35..170 CDD:226989 36/135 (27%)
Jph3NP_065630.1 PLN03185 5..>144 CDD:215619 43/152 (28%)
MORN 1 15..37 3/12 (25%)
MORN 2 39..60 10/24 (42%)
MORN 3 61..82 10/26 (38%)
MORN 4 83..105 4/21 (19%)
MORN 5 107..129 7/21 (33%)
MORN 6 130..152 9/50 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 230..252
PLN03185 287..>342 CDD:215619
MORN 7 288..310
MORN 311..333 CDD:308220
MORN 8 311..333
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 451..603
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 624..677
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4642
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.