DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14490 and JPH1

DIOPT Version :10

Sequence 1:NP_611274.1 Gene:CG14490 / 37041 FlyBaseID:FBgn0034281 Length:197 Species:Drosophila melanogaster
Sequence 2:NP_065698.1 Gene:JPH1 / 56704 HGNCID:14201 Length:661 Species:Homo sapiens


Alignment Length:189 Identity:53/189 - (28%)
Similarity:78/189 - (41%) Gaps:49/189 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 GYSSGVRSQRYPGGQYQGKWLGQQPHGF---GVKQTSSGLVYEGHWQKGQRHGIGSLRRKELDGR 68
            |..:|.:.|    |:|.|.|    .|||   |.....||..|:|:|.:|:|||:|    .|..|:
Human    27 GICTGPKGQ----GEYSGSW----SHGFEVVGGYTWPSGNTYQGYWAQGKRHGLG----VETKGK 79

  Fly    69 MERIYVGQWRENKRSGEG-KQFYPDGSVYFGQWLADQRSGEGILWQADGGIYVGEWLRDKMHEKG 132
            .  :|.|:|....:...| :|.....:.|.|.|....:.|.|:....|||.|.|:|         
Human    80 W--MYRGEWSHGFKGRYGVRQSLCTPARYEGTWSNGLQDGYGVETYGDGGTYQGQW--------- 133

  Fly   133 LLFTATGNRYVGQFEGGCKSGSGVFYHASNGQRIQHGFWS--KDICRTSLLSLPQDKNN 189
                          .||.:.|.||      .|.:.:|..:  :...||||.||..:::|
Human   134 --------------AGGMRHGYGV------RQSVPYGMATVIRSPLRTSLASLRSEQSN 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14490NP_611274.1 COG4642 <18..173 CDD:443680 43/160 (27%)
JPH1NP_065698.1 COG4642 <3..333 CDD:443680 53/189 (28%)
MORN 1 14..36 3/12 (25%)
MORN 2 38..59 9/24 (38%)
MORN 3 60..82 10/27 (37%)
MORN 4 106..128 7/21 (33%)
MORN 5 129..151 9/50 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 228..247
MORN 6 281..303
MORN 7 304..326
PHA03247 <405..571 CDD:223021
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 433..631
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.