DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14490 and morn5

DIOPT Version :10

Sequence 1:NP_611274.1 Gene:CG14490 / 37041 FlyBaseID:FBgn0034281 Length:197 Species:Drosophila melanogaster
Sequence 2:XP_073770087.1 Gene:morn5 / 554117 ZFINID:ZDB-GENE-050522-267 Length:265 Species:Danio rerio


Alignment Length:62 Identity:22/62 - (35%)
Similarity:30/62 - (48%) Gaps:2/62 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 GGIYVGEWLRDKMHEKGLLFTATGNRYVGQFEGGCKSGSGVFYHASNGQRIQHGFWSKDICR 177
            |..|.|::...:|...|.....|..||||:.:.|...|.||. |..||.:.: |.|.|.||:
Zfish     5 GSSYDGDYNNGRMEGTGEYTIPTHTRYVGEMKDGMFHGKGVL-HFPNGSKYE-GTWEKGICK 64

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14490NP_611274.1 COG4642 <18..173 CDD:443680 19/56 (34%)
morn5XP_073770087.1 None

Return to query results.
Submit another query.