DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14490 and morn4

DIOPT Version :10

Sequence 1:NP_611274.1 Gene:CG14490 / 37041 FlyBaseID:FBgn0034281 Length:197 Species:Drosophila melanogaster
Sequence 2:NP_001017559.1 Gene:morn4 / 550131 ZFINID:ZDB-GENE-050417-7 Length:146 Species:Danio rerio


Alignment Length:141 Identity:45/141 - (31%)
Similarity:61/141 - (43%) Gaps:19/141 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 SSGLVYEGHWQKGQRHGIGSLRRKELDGRMERIYVGQWRENKRSGEGKQFYPDGSVYFGQWLADQ 104
            |||..|.|.|::|:|||.|.|  |..||   ..|.|.:......|.|...:||||.|.|::...:
Zfish    11 SSGEEYTGEWKEGRRHGKGEL--KFADG---TCYKGHFENGLFHGSGVLVFPDGSRYEGEFAQGK 70

  Fly   105 RSGEGILWQADGGIYVGEWLRDKMHEKGLLFTATGN----RYVGQFEGG-------CKSGSGVFY 158
            ..|.||..:.||..:.||:...::...|||....|:    |..|.||..       |::   |..
Zfish    71 FQGVGIFSRFDGMKFEGEFKSGRVEGHGLLTFPDGSHGAPRNEGMFENNKLLKREKCQA---VVQ 132

  Fly   159 HASNGQRIQHG 169
            .|.|......|
Zfish   133 RAKNSASTARG 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14490NP_611274.1 COG4642 <18..173 CDD:443680 45/141 (32%)
morn4NP_001017559.1 COG4642 <5..118 CDD:443680 39/111 (35%)

Return to query results.
Submit another query.