DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14490 and Als2cl

DIOPT Version :9

Sequence 1:NP_611274.1 Gene:CG14490 / 37041 FlyBaseID:FBgn0034281 Length:197 Species:Drosophila melanogaster
Sequence 2:XP_006244073.1 Gene:Als2cl / 316017 RGDID:1305208 Length:952 Species:Rattus norvegicus


Alignment Length:222 Identity:63/222 - (28%)
Similarity:86/222 - (38%) Gaps:51/222 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SRTSGYSSGVRSQRYPGGQ------YQGKWLGQQPHGFG---VKQTSS----------------- 41
            ||...:..|  :.::|.|:      |||     ..||||   |.|.|.                 
  Rat   363 SRAKPHGKG--TLKWPDGRNHVGDFYQG-----LEHGFGICLVPQASEDKFDCYKCHWREGRMCE 420

  Fly    42 -GL-------VYEGHWQKGQRHGIGSLRRKELDGRMERIYVGQWRENKRSGEGKQFYPD-GSVYF 97
             |:       ||:|::|.|.|||.|.|.......:..| |.|.|...:|||.|.:...| |..|.
  Rat   421 YGICEYGTDEVYKGYFQAGVRHGFGVLDSAPQAPQPFR-YTGHWERGQRSGYGIEEDRDRGERYI 484

  Fly    98 GQWLADQRSGEGILWQADGGIYVGEWLRDKMHEKGLLFTATGNRYVGQF--------EGGCKSGS 154
            |.|.||||.|.||:....|..|.|.:..|||...|:|.....:.|.|.|        :|.....:
  Rat   485 GMWQADQRHGPGIVVTQAGVCYQGTFQGDKMAGPGILLCEDDSLYEGTFTRELTLLGKGKVTFPN 549

  Fly   155 GVFYHASNGQRIQHGFWSKDICRTSLL 181
            |.....|.......|.:::.:..|:.|
  Rat   550 GFTLEGSFCSGTDKGLYTQGVLDTTAL 576

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14490NP_611274.1 COG4642 35..170 CDD:226989 49/171 (29%)
Als2clXP_006244073.1 PH-like 223..321 CDD:418428
PLN03185 357..>550 CDD:215619 58/194 (30%)
VPS9 835..937 CDD:388595
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166350923
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4642
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.