DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14490 and Morn4

DIOPT Version :9

Sequence 1:NP_611274.1 Gene:CG14490 / 37041 FlyBaseID:FBgn0034281 Length:197 Species:Drosophila melanogaster
Sequence 2:NP_001020146.1 Gene:Morn4 / 293950 RGDID:1307336 Length:146 Species:Rattus norvegicus


Alignment Length:137 Identity:35/137 - (25%)
Similarity:54/137 - (39%) Gaps:30/137 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 SSGLVYEGHWQKGQRHGIGSLRRKELDGRMERIYVGQWRENKRSGEGKQFYPDGSVYFGQWLADQ 104
            |||..|.|.|::|:|||.|.|                            .:.||..|.|.:....
  Rat    11 SSGEEYRGEWKEGRRHGFGQL----------------------------MFADGGTYLGHFENGL 47

  Fly   105 RSGEGILWQADGGIYVGEWLRDKMHEKGLLFTATGNRYVGQFEGGCKSGSGV--FYHASNGQRIQ 167
            .:|.|:|..:||..|.||:.:.|.:..|:........:.|:|:.|...|.|:  |...|:|....
  Rat    48 FNGFGVLTFSDGSRYEGEFSQGKFNGVGVFIRYDNMTFEGEFKNGRVDGFGLLTFPDGSHGLPRN 112

  Fly   168 HGFWSKD 174
            .|.:..:
  Rat   113 EGLFENN 119

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14490NP_611274.1 COG4642 35..170 CDD:226989 34/131 (26%)
Morn4NP_001020146.1 COG4642 5..106 CDD:226989 32/122 (26%)
MORN 1 16..38 11/49 (22%)
MORN 2 39..61 7/21 (33%)
MORN 3 62..84 5/21 (24%)
MORN 4 85..107 6/21 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4642
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.