DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14490 and Rsph10b

DIOPT Version :9

Sequence 1:NP_611274.1 Gene:CG14490 / 37041 FlyBaseID:FBgn0034281 Length:197 Species:Drosophila melanogaster
Sequence 2:XP_006248920.1 Gene:Rsph10b / 288478 RGDID:1311893 Length:906 Species:Rattus norvegicus


Alignment Length:196 Identity:60/196 - (30%)
Similarity:83/196 - (42%) Gaps:50/196 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 GGQYQGKWLGQQPHGFGV-KQTSSGLVYEGHWQKGQRHGIGSLRRKELDGRMERIYVGQWRENKR 82
            |..|:|:.:....:|||: |..:..:.|.|||..|:|||.||:...: :|  ...|.|.|..|.:
  Rat   182 GSTYEGEVVNGMRNGFGMFKCGTQPVSYIGHWCHGKRHGKGSIYYNQ-EG--TSWYEGDWVYNIK 243

  Fly    83 SGEGKQFYPDGSVYFGQWLADQRSGEG-ILWQADGGIYVGEWLRDKMHEKGL---LFTAT----- 138
            .|.|.:.|..|::|.|||..:.|.||| :.|......|.|.|      |||:   ..|.|     
  Rat   244 KGWGIRCYKSGNIYEGQWENNMRHGEGRMRWLTTNEEYTGHW------EKGIQNGFGTHTWFLKR 302

  Fly   139 --------GNRYVGQFEGGCKSGSGVFYHAS----------------------NGQRIQHGFWSK 173
                    .|.|:|.|..|.:.|.|.||:||                      || |:..|.:|.
  Rat   303 IPNSQYPLRNEYIGAFVNGFRHGQGKFYYASGAMYEGEWVSNKKQGRGRITFKNG-RVYEGLFSN 366

  Fly   174 D 174
            |
  Rat   367 D 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14490NP_611274.1 COG4642 35..170 CDD:226989 52/174 (30%)
Rsph10bXP_006248920.1 PLN03185 86..>200 CDD:215619 6/17 (35%)
PLN03185 158..>421 CDD:215619 60/196 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4642
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1309439at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.