Sequence 1: | NP_611274.1 | Gene: | CG14490 / 37041 | FlyBaseID: | FBgn0034281 | Length: | 197 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_006248920.1 | Gene: | Rsph10b / 288478 | RGDID: | 1311893 | Length: | 906 | Species: | Rattus norvegicus |
Alignment Length: | 196 | Identity: | 60/196 - (30%) |
---|---|---|---|
Similarity: | 83/196 - (42%) | Gaps: | 50/196 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 19 GGQYQGKWLGQQPHGFGV-KQTSSGLVYEGHWQKGQRHGIGSLRRKELDGRMERIYVGQWRENKR 82
Fly 83 SGEGKQFYPDGSVYFGQWLADQRSGEG-ILWQADGGIYVGEWLRDKMHEKGL---LFTAT----- 138
Fly 139 --------GNRYVGQFEGGCKSGSGVFYHAS----------------------NGQRIQHGFWSK 173
Fly 174 D 174 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG14490 | NP_611274.1 | COG4642 | 35..170 | CDD:226989 | 52/174 (30%) |
Rsph10b | XP_006248920.1 | PLN03185 | 86..>200 | CDD:215619 | 6/17 (35%) |
PLN03185 | 158..>421 | CDD:215619 | 60/196 (31%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG4642 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1309439at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.910 |