DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14490 and MORN3

DIOPT Version :10

Sequence 1:NP_611274.1 Gene:CG14490 / 37041 FlyBaseID:FBgn0034281 Length:197 Species:Drosophila melanogaster
Sequence 2:NP_776254.3 Gene:MORN3 / 283385 HGNCID:29807 Length:240 Species:Homo sapiens


Alignment Length:186 Identity:69/186 - (37%)
Similarity:106/186 - (56%) Gaps:6/186 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 SGVRSQRYP--GGQYQGKWLGQQPHGFGVK-QTSSGLVYEGHWQKGQRHGIGSLRRKELD-GRME 70
            :|:|||.|.  |..|.|:|.....||.|.: ....|.:|||.|:.|:|.|.|:|...:.. |:..
Human    24 NGLRSQVYAVNGDYYVGEWKDNVKHGKGTQVWKKKGAIYEGDWKFGKRDGYGTLSLPDQQTGKCR 88

  Fly    71 RIYVGQWRENKRSGEGKQFYPDGSVYFGQWLADQRSGEGILWQADGGIYVGEWLRDKMHEKGLLF 135
            |:|.|.|:.:|:||.|.||:.....|.|.|...||||.|.::.::|.||.|:|..||.:.:|:|.
Human    89 RVYSGWWKGDKKSGYGIQFFGPKEYYEGDWCGSQRSGWGRMYYSNGDIYEGQWENDKPNGEGMLR 153

  Fly   136 TATGNRYVGQFEGGCKSGSGVFYHASNGQRIQHGFWSKDICRT-SLLSLPQDKNNE 190
            ...||||.|.:|.|.|:|:|.|:|..:||..: |||..::.:. :::...:|:..|
Human   154 LKNGNRYEGCWERGMKNGAGRFFHLDHGQLFE-GFWVDNMAKCGTMIDFGRDEAPE 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14490NP_611274.1 COG4642 <18..173 CDD:443680 62/158 (39%)
MORN3NP_776254.3 Interaction with MDM2. /evidence=ECO:0000269|PubMed:29681526 6..35 5/10 (50%)
COG4642 <16..190 CDD:443680 67/166 (40%)
MORN 1 38..60 6/21 (29%)
MORN 2 62..84 9/21 (43%)
Interaction with SIRT1. /evidence=ECO:0000269|PubMed:29681526 76..100 6/23 (26%)
MORN 3 91..113 9/21 (43%)
MORN 4 114..136 9/21 (43%)
MORN 5 137..159 8/21 (38%)
MORN 6 160..182 9/21 (43%)
MORN 7 184..205 3/21 (14%)
Interaction with TP53. /evidence=ECO:0000269|PubMed:29681526 206..240 1/3 (33%)

Return to query results.
Submit another query.