DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14490 and ALS2CL

DIOPT Version :9

Sequence 1:NP_611274.1 Gene:CG14490 / 37041 FlyBaseID:FBgn0034281 Length:197 Species:Drosophila melanogaster
Sequence 2:NP_001177636.1 Gene:ALS2CL / 259173 HGNCID:20605 Length:953 Species:Homo sapiens


Alignment Length:177 Identity:52/177 - (29%)
Similarity:79/177 - (44%) Gaps:12/177 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 YQGKWLGQQPHGFGVKQTSSGLVYEGHWQKGQRHGIGSLRRKELDGRMERIYVGQWRENKRSGEG 86
            |:..|......|:|:.:.|:..||:|::|:|.|||.|.|.......:..| |.|.|...:|||.|
Human   409 YKCHWREGSMCGYGICEYSTDEVYKGYFQEGLRHGFGVLESGPQAPQPFR-YTGHWERGQRSGYG 472

  Fly    87 KQFYPD-GSVYFGQWLADQRSGEGILWQADGGIYVGEWLRDKMHEKGLLFTATGNRYVGQF---- 146
            .:...| |..|.|.|.|.||.|.|::....|..|.|.:..||....|:|.:...:.|.|.|    
Human   473 IEEDGDRGERYIGMWQAGQRHGPGVMVTQAGVCYQGTFQADKTVGPGILLSEDDSLYEGTFTRDL 537

  Fly   147 ----EGGCKSGSGVFYHASNGQRIQHGFWSKDICRTSLLSLPQDKNN 189
                :|.....:|.....|.|.....|..::.:..|:  :||.|.::
Human   538 TLMGKGKVTFPNGFTLEGSFGSGAGRGLHTQGVLDTA--ALPPDPSS 582

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14490NP_611274.1 COG4642 35..170 CDD:226989 44/143 (31%)
ALS2CLNP_001177636.1 PH-like 223..321 CDD:302622
COG4642 358..519 CDD:226989 38/110 (35%)
MORN 1 358..380
MORN 358..378 CDD:280628
MORN 2 381..403
MORN 3 409..431 5/21 (24%)
MORN 4 432..452 9/19 (47%)
MORN 5 459..479 7/19 (37%)
COG4642 480..>569 CDD:226989 24/88 (27%)
MORN 6 483..505 9/21 (43%)
MORN 7 506..528 6/21 (29%)
MORN 8 529..552 5/22 (23%)
VPS9 834..938 CDD:280383
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165156966
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4642
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.