| Sequence 1: | NP_611274.1 | Gene: | CG14490 / 37041 | FlyBaseID: | FBgn0034281 | Length: | 197 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001139531.1 | Gene: | Als2cl / 235633 | MGIID: | 2447532 | Length: | 952 | Species: | Mus musculus |
| Alignment Length: | 237 | Identity: | 57/237 - (24%) |
|---|---|---|---|
| Similarity: | 84/237 - (35%) | Gaps: | 63/237 - (26%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 13 RSQRYPGGQYQGKWLGQQPHG-------------------------------------------- 33
Fly 34 -------FGVKQTSSGLVYEGHWQKGQRHGIGSLRRKELDGRMERIYVGQWRENKRSGEGKQFYP 91
Fly 92 D-GSVYFGQWLADQRSGEGILWQADGGIYVGEWLRDKMHEKGLLFTATGNRYVGQF--------E 147
Fly 148 GGCKSGSGVFYHASNGQRIQHGFWSKDICRTSLLSLPQDKNN 189 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG14490 | NP_611274.1 | COG4642 | 35..170 | CDD:226989 | 44/143 (31%) |
| Als2cl | NP_001139531.1 | PH-like | 223..321 | CDD:388408 | |
| PLN03185 | 357..>550 | CDD:215619 | 48/193 (25%) | ||
| MORN 1 | 358..380 | 6/21 (29%) | |||
| MORN 2 | 381..403 | 0/21 (0%) | |||
| MORN 3 | 409..431 | 1/21 (5%) | |||
| MORN 4 | 432..454 | 9/21 (43%) | |||
| MORN 5 | 459..481 | 8/21 (38%) | |||
| MORN 6 | 483..505 | 10/21 (48%) | |||
| MORN 7 | 506..528 | 7/21 (33%) | |||
| MORN 8 | 529..552 | 5/22 (23%) | |||
| VPS9 | 835..937 | CDD:388595 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C167847369 | |
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_COG4642 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.830 | |||||