Sequence 1: | NP_611274.1 | Gene: | CG14490 / 37041 | FlyBaseID: | FBgn0034281 | Length: | 197 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_011513505.1 | Gene: | RSPH10B / 222967 | HGNCID: | 27362 | Length: | 875 | Species: | Homo sapiens |
Alignment Length: | 217 | Identity: | 64/217 - (29%) |
---|---|---|---|
Similarity: | 92/217 - (42%) | Gaps: | 54/217 - (24%) |
- Green bases have known domain annotations that are detailed below.
Fly 19 GGQYQGKWLGQQPHGFGV-KQTSSGLVYEGHWQKGQRHGIGSLRRKELDGRMERIYVGQWRENKR 82
Fly 83 SGEGKQFYPDGSVYFGQWLADQRSGEG-ILWQADGGIYVGEWLRDKMHEKGLLFTAT-------- 138
Fly 139 -----GNRYVGQFEGGCKSGSGVFYHAS---------------------------NGQRIQHGFW 171
Fly 172 SKDICRTSLLSLPQDKNNEFMS 193 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG14490 | NP_611274.1 | COG4642 | 35..170 | CDD:226989 | 51/176 (29%) |
RSPH10B | XP_011513505.1 | COG4642 | <86..162 | CDD:226989 | 3/9 (33%) |
PLN03185 | 128..>318 | CDD:215619 | 53/171 (31%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1309439at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.010 |