DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14490 and MORN4

DIOPT Version :9

Sequence 1:NP_611274.1 Gene:CG14490 / 37041 FlyBaseID:FBgn0034281 Length:197 Species:Drosophila melanogaster
Sequence 2:XP_011537552.1 Gene:MORN4 / 118812 HGNCID:24001 Length:204 Species:Homo sapiens


Alignment Length:161 Identity:43/161 - (26%)
Similarity:62/161 - (38%) Gaps:31/161 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 GQQPHGFGVKQTSSGLV-------------------YEGHWQKGQRHGIGSLRR----KELDGRM 69
            |..|...|..|.::|:|                   ....||.| .|...|.||    ...||..
Human    12 GVAPGCLGNSQWAAGIVPSAVAQDGGVKWGNRWWRWRRARWQPG-AHQRKSPRRWNPASRRDGHP 75

  Fly    70 ERIYVGQWRENKRSGEGKQFYPDGSVYFGQWLADQRSGEGILWQADGGIYVGEWLRDKMHEKGLL 134
            ||...|     :|.|.|:..:.||..|.|.:.....:|.|:|..:||..|.||:.:.|.:..|:.
Human    76 ERPAPG-----RRHGFGQLMFADGGTYLGHFENGLFNGFGVLTFSDGSRYEGEFAQGKFNGVGVF 135

  Fly   135 FTATGNRYVGQFEGGCKSGSGV--FYHASNG 163
            .......:.|:|:.|...|.|:  |...|:|
Human   136 IRYDNMTFEGEFKNGRVDGFGLLTFPDGSHG 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14490NP_611274.1 COG4642 35..170 CDD:226989 41/154 (27%)
MORN4XP_011537552.1 COG4642 <81..179 CDD:226989 26/91 (29%)
MORN 97..119 CDD:280628 7/21 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4642
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.