DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14490 and rsph1

DIOPT Version :9

Sequence 1:NP_611274.1 Gene:CG14490 / 37041 FlyBaseID:FBgn0034281 Length:197 Species:Drosophila melanogaster
Sequence 2:XP_031753300.1 Gene:rsph1 / 100489385 XenbaseID:XB-GENE-5945700 Length:300 Species:Xenopus tropicalis


Alignment Length:157 Identity:57/157 - (36%)
Similarity:91/157 - (57%) Gaps:15/157 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 GQYQGK--WLGQQPHGFGVKQTSSGLVYEGHWQKGQRHGIGSLRRKELDGRMERIYVGQWRENKR 82
            |:|:|:  ..|:: ||.|..:..:|..|||.::.|:|||.|:.|.|  :|..   |:|::::||:
 Frog    18 GEYEGERNEAGER-HGQGRARLPNGDTYEGQYEGGKRHGQGTYRFK--NGAR---YIGEYQQNKK 76

  Fly    83 SGEGKQFYPDGSVYFGQWLADQRSGEGILWQADGGIYVGEWLRDKMHEKGL-LFTATGNRYVGQF 146
            .|.|...|||||.|.|.|:.|||.|:|:.:..:|..|.|:||..:.|.:|: .:..||::|||.:
 Frog    77 HGAGTFMYPDGSKYEGDWVDDQRQGQGVYYYPNGDTYSGDWLSHQRHGQGVYTYAETGSKYVGTW 141

  Fly   147 EGGCKSGSGVFYHASNGQRIQHGFWSK 173
            ..|.:.|||...|      :.|.:..|
 Frog   142 VNGKQEGSGELVH------LNHRYQGK 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14490NP_611274.1 COG4642 35..170 CDD:226989 50/135 (37%)
rsph1XP_031753300.1 PLN03185 20..>150 CDD:215619 51/135 (38%)
gliding_GltJ <222..>284 CDD:411345
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1309439at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.