DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14490 and rsph1

DIOPT Version :9

Sequence 1:NP_611274.1 Gene:CG14490 / 37041 FlyBaseID:FBgn0034281 Length:197 Species:Drosophila melanogaster
Sequence 2:XP_009302854.1 Gene:rsph1 / 100003444 ZFINID:ZDB-GENE-041008-22 Length:232 Species:Danio rerio


Alignment Length:154 Identity:53/154 - (34%)
Similarity:81/154 - (52%) Gaps:11/154 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 GQYQG--KWLGQQPHGFGVKQTSSGLVYEGHWQKGQRHGIGSLRRKELDGRMERIYVGQWRENKR 82
            |:|:|  ...|:: ||.|.....:|..|:|.::.|:|...|:.:.|  :|..   |.|:|..|.:
Zfish    17 GEYEGDRNEAGER-HGQGKAVLPNGDTYQGAYENGKRSSQGTYKFK--NGAR---YTGEWYMNLK 75

  Fly    83 SGEGKQFYPDGSVYFGQWLADQRSGEGILWQADGGIYVGEWLRDKMHEKG-LLFTATGNRYVGQF 146
            .|||..:|||||.|.|.|:.|||.|.|:....:|..|.||||..:.|.:| ..:..||::|||.:
Zfish    76 HGEGTFYYPDGSKYEGTWVDDQRQGLGVYTYPNGDTYDGEWLHHQRHGQGAYTYHDTGSQYVGTW 140

  Fly   147 EGGCKSGSGVFYHASNGQRIQHGF 170
            ..|....:|...:.::  |.|..|
Zfish   141 IMGKMESAGELIYLNH--RYQGNF 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14490NP_611274.1 COG4642 35..170 CDD:226989 46/135 (34%)
rsph1XP_009302854.1 COG4642 19..>143 CDD:332236 47/129 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1309439at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.