DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment olf186-F and ORAI1

DIOPT Version :9

Sequence 1:NP_001137696.1 Gene:olf186-F / 37040 FlyBaseID:FBgn0041585 Length:507 Species:Drosophila melanogaster
Sequence 2:NP_116179.2 Gene:ORAI1 / 84876 HGNCID:25896 Length:301 Species:Homo sapiens


Alignment Length:274 Identity:138/274 - (50%)
Similarity:170/274 - (62%) Gaps:56/274 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   254 PPFAAQPPPFQLRTYQQ--NQSYRFQPRGHHRTASSSMSQSGEDLHSPTYLSWRKLQLSRAKLKA 316
            ||.|..|||..: ||..  .|||           |..||.:.   ||...||||||.||||||||
Human    39 PPGAPPPPPSAV-TYPDWIGQSY-----------SEVMSLNE---HSMQALSWRKLYLSRAKLKA 88

  Fly   317 SSKTSALLSGFAMVAMVEVQLDHDTNVPPGMLIAFAICTTLLVAVHMLALMISTCILPNIETVCN 381
            ||:|||||||||||||||||||.|.:.|||:||||:.|||:|||||:.|||||||||||||.|.|
Human    89 SSRTSALLSGFAMVAMVEVQLDADHDYPPGLLIAFSACTTVLVAVHLFALMISTCILPNIEAVSN 153

  Fly   382 LHSISLVHESPHERLHWYIETAWAFSTLLGLILFLLEIAILCWVKFYDL-----------SPPAA 435
            :|:::.|.||||||:|.:||.||||||::|.:|||.|:.:||||||..|           .|||:
Human   154 VHNLNSVKESPHERMHRHIELAWAFSTVIGTLLFLAEVVLLCWVKFLPLKKQPGQPRPTSKPPAS 218

  Fly   436 WSAC------------------VVLIPVMIIFMAFAIHFYRSLVSHKYEVTVSGIRELEMLKEQM 482
            .:|.                  .:::|..:||:.||:||||||||||.:      |:.:.|.|..
Human   219 GAAANVSTSGITPGQAAAIASTTIMVPFGLIFIVFAVHFYRSLVSHKTD------RQFQELNELA 277

  Fly   483 E----QDHLEHHNN 492
            |    ||.|:|..:
Human   278 EFARLQDQLDHRGD 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
olf186-FNP_001137696.1 Orai-1 301..466 CDD:285140 114/193 (59%)
ORAI1NP_116179.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..51 6/12 (50%)
Interaction with STIM1 70..90 15/19 (79%)
Orai-1 73..267 CDD:285140 114/193 (59%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 205..225 4/19 (21%)
Interaction with STIM1 272..292 7/20 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 233 1.000 Domainoid score I2403
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 244 1.000 Inparanoid score I3302
Isobase 1 0.950 - 0 Normalized mean entropy S4680
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002138
OrthoInspector 1 1.000 - - otm41020
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3030
SonicParanoid 1 1.000 - - X1421
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
98.940

Return to query results.
Submit another query.