DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment olf186-F and Orai3

DIOPT Version :9

Sequence 1:NP_001137696.1 Gene:olf186-F / 37040 FlyBaseID:FBgn0041585 Length:507 Species:Drosophila melanogaster
Sequence 2:NP_001014046.1 Gene:Orai3 / 309000 RGDID:1306538 Length:290 Species:Rattus norvegicus


Alignment Length:299 Identity:123/299 - (41%)
Similarity:166/299 - (55%) Gaps:80/299 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   243 APLAPLASIASPPFAAQPPPFQLRTYQQNQSYRFQPRGHHRTASSSMSQSGEDLHSPTYLSWRKL 307
            |||.|  .:.||..:|        ||::     |..||:       :...|...||...||||:|
  Rat    12 APLNP--EVDSPAGSA--------TYRE-----FVHRGY-------LDLMGASQHSLRALSWRRL 54

  Fly   308 QLSRAKLKASSKTSALLSGFAMVAMVEVQLDHDTNVPPGMLIAFAICTTLLVAVHMLALMISTCI 372
            .||||||||||:||||||||||||||||||:.|...|||:|:||:.|||:|||||:.|||:|||:
  Rat    55 YLSRAKLKASSRTSALLSGFAMVAMVEVQLESDHEYPPGLLVAFSACTTVLVAVHLFALMVSTCL 119

  Fly   373 LPNIETVCNLHSISLVHESPHERLHWYIETAWAFSTLLGLILFLLEIAILCWVKFYDLSPP---- 433
            ||:||.|.|:|:::.||:|||:|||.|:|.||.|||.||..|||.|:.::.||||..:..|    
  Rat   120 LPHIEAVSNIHNLNSVHQSPHQRLHRYVELAWGFSTALGTFLFLAEVVLVGWVKFVPIGAPMDKP 184

  Fly   434 ------------------------------------------------------AAWSACVVLIP 444
                                                                  ||.::..:::|
  Rat   185 APVVPMSQVPPVTVSLSLASNLTPSSASVATTQQPPKACPPRQVCGSAHGPGWQAAMASTAIMVP 249

  Fly   445 VMIIFMAFAIHFYRSLVSHKYEVTVSGIRELEMLKEQME 483
            |.::|||||:|||||||:||.:.....:.||..|:.:::
  Rat   250 VGLVFMAFALHFYRSLVAHKTDRHKQELEELSRLQGELQ 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
olf186-FNP_001137696.1 Orai-1 301..466 CDD:285140 105/222 (47%)
Orai3NP_001014046.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21 4/10 (40%)
Orai-1 48..271 CDD:285140 105/222 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166351326
Domainoid 1 1.000 218 1.000 Domainoid score I2568
eggNOG 1 0.900 - - E1_KOG4298
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 240 1.000 Inparanoid score I3256
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002138
OrthoInspector 1 1.000 - - otm45155
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR31501
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1421
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1211.850

Return to query results.
Submit another query.