DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment olf186-M and itprid2

DIOPT Version :9

Sequence 1:NP_611272.1 Gene:olf186-M / 37039 FlyBaseID:FBgn0015522 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001072601.3 Gene:itprid2 / 780056 XenbaseID:XB-GENE-981013 Length:1225 Species:Xenopus tropicalis


Alignment Length:156 Identity:47/156 - (30%)
Similarity:63/156 - (40%) Gaps:38/156 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 ADLEENADPDAHEHMSPVVTMPMRHISATSTRCLRHEESFESS-STAPELSPQAQRQQRFS---S 126
            |.|:|..:|                :|:.....|::..|||.. |...|.:...||.....   :
 Frog    77 ASLDEQNNP----------------VSSQKGMLLKNGGSFEDDLSLGAEANHLLQRNLSMDTPFA 125

  Fly   127 LLLRD------------SSVSVQSDSSRYSSVDSLLEARKPDPEAILINLGFGPLSSEDMLSRIP 179
            ||.:|            :|......|:..|||..||:..:.|||.||.|||||. ...|:.|:||
 Frog   126 LLAKDRRLQFHQKGRSMNSTGSGKSSTTVSSVSELLDLYEEDPEEILYNLGFGK-DEPDIASKIP 189

  Fly   180 RRFLKP-SQVPGIDTDAF----VQRL 200
            .||... |...|||...|    :|||
 Frog   190 SRFFNNCSLAHGIDIKLFLNAQMQRL 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
olf186-MNP_611272.1 KRAP_IP3R_bind 144..>200 CDD:291392 27/60 (45%)
itprid2NP_001072601.3 KRAP_IP3R_bind 136..282 CDD:405421 31/81 (38%)
SSFA2_C 835..1011 CDD:405422
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005638
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.