DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment olf186-M and Tespa1

DIOPT Version :9

Sequence 1:NP_611272.1 Gene:olf186-M / 37039 FlyBaseID:FBgn0015522 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_899087.2 Gene:Tespa1 / 67596 MGIID:1914846 Length:458 Species:Mus musculus


Alignment Length:210 Identity:57/210 - (27%)
Similarity:85/210 - (40%) Gaps:43/210 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 SVHFPPSKPLRRRRKLQRQQSAVDTDDMEYAADLEENADP------DAHEHMSPVVTMP--MRHI 91
            ||..|.|...||....|.:.......:.|.||.|::..||      |..:..:|:..:.  ::..
Mouse     4 SVLSPTSWEKRRAWLRQSRNWQTQVLEEEAAAALQDALDPEPSSLDDVFQEGNPINKIEDWLQGC 68

  Fly    92 SATSTRCLRHEESFES---------SSTAPELSPQAQ----------------RQQRFSSLLLRD 131
            ....|.....|||.:|         :|...:||..|:                :..|...||...
Mouse    69 GCRDTEEGLSEESGQSNYSGYSSHGTSFEDDLSLGAEATLLSTNGNLFSRNFLQTPRLCQLLDLG 133

  Fly   132 SSVSVQS----DSSRYSSVDSLLEARKPDPEAILINLGFGPLSSEDMLSRIPRRFL-KPSQVPGI 191
            ||::..|    .:...||:..:|:..:.|.|.||.:||||..:.:| .||||.||. .|||..||
Mouse   134 SSLASSSMTGGTNKTSSSISEILDQVQEDAEDILFSLGFGHENHKD-TSRIPARFFSNPSQAKGI 197

  Fly   192 DTDAF----VQRLTL 202
            :...|    |||:.:
Mouse   198 NFQLFLKSQVQRMEM 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
olf186-MNP_611272.1 KRAP_IP3R_bind 144..>200 CDD:291392 26/60 (43%)
Tespa1NP_899087.2 KRAP_IP3R_bind 130..251 CDD:373246 31/84 (37%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 328..356
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 439..458
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005638
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.