DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment grh and TFCP2

DIOPT Version :9

Sequence 1:NP_476845.2 Gene:grh / 37038 FlyBaseID:FBgn0259211 Length:1333 Species:Drosophila melanogaster
Sequence 2:NP_005644.2 Gene:TFCP2 / 7024 HGNCID:11748 Length:502 Species:Homo sapiens


Alignment Length:481 Identity:129/481 - (26%)
Similarity:203/481 - (42%) Gaps:102/481 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   903 FRYHLESPISSSQRREDDRITYINKGQFYGI-TLEYVHDAEKP-IKNTTVKSVIMLMFREEKSPE 965
            |:|.|.:..|.:.:..|:.:||:|:||.|.| .|:.....|.| |....|||:..::|.:.:...
Human    67 FQYVLCAATSPAVKLHDETLTYLNQGQSYEIRMLDNRKLGELPEINGKLVKSIFRVVFHDRRLQY 131

  Fly   966 DEIKAWQFWHSRQHSVKQRILDADTKNSVGLVG-CIEEVSHNAIAVYWNPLESSAKINIAVQCLS 1029
            .|.:..:.|  |.:....||||.|...|||::. .......|.:...|:|.:.:: :.|.|.|:|
Human   132 TEHQQLEGW--RWNRPGDRILDIDIPMSVGIIDPRANPTQLNTVEFLWDPAKRTS-VFIQVHCIS 193

  Fly  1030 TDFSSQK--GVKGLPLHVQIDTFEDPRD---TAVFHRGYCQIKVFCDKGAERKTRDEERRAAKRK 1089
            |:|:.:|  |.||:|..||||||::..:   |...|...||||||..|||:||.:.:..:..|| 
Human   194 TEFTMRKHGGEKGVPFRVQIDTFKENENGEYTEHLHSASCQIKVFKPKGADRKQKTDREKMEKR- 257

  Fly  1090 MTATGRKKLDELYHPVTDRSEFYGMQDFAKPPVL--FSPAEDMEKVGQLGIGAATGMTFNPLSNG 1152
               |..:|  |.|.|..:.:            :|  .||..::..|.            |..|.|
Human   258 ---TPHEK--EKYQPSYETT------------ILTECSPWPEITYVN------------NSPSPG 293

  Fly  1153 NSNSNSHSSLQSFYG---HETDSPD------LKGASP----FLLHGQKVATPTLKFHNHFPPDMQ 1204
            .::|:|..||....|   |:.:.|.      |...:|    ..||..:.:|.|..|.|....|:.
Human   294 FNSSHSSFSLGEGNGSPNHQPEPPPPVTDNLLPTTTPQEAQQWLHRNRFSTFTRLFTNFSGADLL 358

  Fly  1205 TDKKDHILDQNMLTSTPLTDFGPP-------MKRGRMTPPTSERVMLYVRQENEE---------- 1252
            ...:|.::.          ..||.       ..:|||..|   |:.:||.||:.:          
Human   359 KLTRDDVIQ----------ICGPADGIRLFNALKGRMVRP---RLTIYVCQESLQLREQQQQQQQ 410

  Fly  1253 ---------------VYTPLHVVPPTTIGLLNAIENKYKISTTSINNIYRTNKKGITAKIDDDMI 1302
                           ||..:::...|.:.|...|...:.||...|:.||:....||...|.|:||
Human   411 QQQKHEDGDSNGTFFVYHAIYLEELTAVELTEKIAQLFSISPCQISQIYKQGPTGIHVLISDEMI 475

  Fly  1303 SFYCNEDIFLLEVQQIE-DDLYDVTL 1327
            ..:..|..|:|:..:.| :|.|.:.|
Human   476 QNFQEEACFILDTMKAETNDSYHIIL 501

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
grhNP_476845.2 CP2 903..1089 CDD:282385 65/193 (34%)
TFCP2NP_005644.2 CP2 52..259 CDD:398291 66/198 (33%)
DNA-binding 133..395 83/307 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 238..268 12/35 (34%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 294..325 7/30 (23%)
SAM_TFCP2 329..395 CDD:188988 17/78 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4091
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.